PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSVIVT01037024001
Common NameLOC100248056, VIT_03s0088g00600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; rosids incertae sedis; Vitales; Vitaceae; Vitis
Family M-type_MADS
Protein Properties Length: 215aa    MW: 24212.1 Da    PI: 9.7955
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSVIVT01037024001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF67.91e-212164649
                       HHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEE CS
             SRF-TF  6 ksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyey 49
                       +sn qvtfskRr g++KKA+EL++LC+ae a+i+fs+  kly +
  GSVIVT01037024001 21 ESNLQVTFSKRRSGLFKKASELCTLCGAETAIIVFSPGKKLYSF 64
                       7899**************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.0E-29867IPR002100Transcription factor, MADS-box
PROSITE profilePS5006622.988868IPR002100Transcription factor, MADS-box
SuperFamilySSF554556.54E-26981IPR002100Transcription factor, MADS-box
CDDcd002652.40E-34977No hitNo description
PRINTSPR004044.4E-181030IPR002100Transcription factor, MADS-box
PfamPF003191.2E-231864IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-183045IPR002100Transcription factor, MADS-box
PRINTSPR004044.4E-184566IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 215 aa     Download sequence    Send to blast
MATVRKSKGR QKVEMTKMTK ESNLQVTFSK RRSGLFKKAS ELCTLCGAET AIIVFSPGKK  60
LYSFGHPCVE SIIDRFLMRN PLPNSGALQL FEAHRTTNVR NLNVQLTQVV NQLEGEKKRG  120
EALTQMWKAC KPQCWWAAPI EEFSLEQLEL LKVSLEDLRR KVARQADELM IEAKNPPAFF  180
PGNSVGTIMP YDAQMAGFDP YSHKYNFGYG GPFL*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4457330.0AM445733.2 Vitis vinifera contig VV78X035203.4, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002270922.11e-161PREDICTED: agamous-like MADS-box protein AGL62
SwissprotQ9FKK25e-64AGL62_ARATH; Agamous-like MADS-box protein AGL62
TrEMBLD7T3N01e-161D7T3N0_VITVI; Putative uncharacterized protein
STRINGVIT_03s0088g00600.t011e-161(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP1617761
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60440.13e-65AGAMOUS-like 62